Amyloid β-Protein (1-39)

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-OH

Placeholder

Product Number: 4073896

CAS Number: 115427-62-8

€ 190.50 – € 346.70

Custom/Bulk Quote

Pack size available	0.5mg, 1mg

Please select pack size:

Pack size available

Clear

Add to your inquiry

Product Description

Small quantities of Aβ37, 38 and 39 can be detected in CSF together with Aβ40, the most abundant Aβ homolog, Aβ42, and N-terminally truncated amyloid peptides. The relative amounts depend on the variant of Alzheimer’s disease. The C-terminally truncated amyloid peptides are also found in amyloid plaques.

ADS

ADS lookup

MSDS

MSDS lookup

Amyloid Beta Peptides & Alzheimer's Disease

Development of high affinity selective VIP1 receptor agonists.

P.Gourlet et al., Peptides, 18, 1539 (1997)

CSF amyloid-beta-peptides in Alzheimer's disease, dementia with Lewy bodies and Parkinson's disease dementia.

M.Bibl et al., Brain, 129, 1177 (2006)

Highly conserved and disease-specific patterns of carboxyterminally truncated Abeta peptides 1-37/38/39 in addition to 1-40/42 in Alzheimer's disease and in patients with chronic neuroinflammation.

J.Wiltfang et al., J. Neurochem., 81, 481 (2002)

Beta-amyloid peptide variants in brains and cerebrospinal fluid from amyloid precursor protein (APP) transgenic mice: comparison with human Alzheimer amyloid.

H.Schieb et al., J. Biol. Chem., 286, 33747 (2011)

Overlapping profiles of Aβ peptides in the Alzheimer's disease and pathological aging brains.

B.D.Moore et al., Alzheimer Res. Ther., 4, 18 (2012)

CSF amyloid-beta-peptides in Alzheimer's disease, dementia with Lewy bodies and Parkinson's disease dementia.

M.Bibl et al., Brain, 129, 1177 (2006)

Highly conserved and disease-specific patterns of carboxyterminally truncated Abeta peptides 1-37/38/39 in addition to 1-40/42 in Alzheimer's disease and in patients with chronic neuroinflammation.

J.Wiltfang et al., J. Neurochem., 81, 481 (2002)

Beta-amyloid peptide variants in brains and cerebrospinal fluid from amyloid precursor protein (APP) transgenic mice: comparison with human Alzheimer amyloid.

H.Schieb et al., J. Biol. Chem., 286, 33747 (2011)

Salt form: Trifluoroacetate

Molecular weight: 4230.73

Chemical Formula: C₁₈₉H₂₈₆N₅₂O₅₇S

Storage Temperature: < -15°C

One Letter code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV

Source: Synthetic

Old Product Number: H-7458

Country

Inquiry List