Copeptin (human)

H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH

Placeholder

Product Number: 4066428

CAS Number: 78362-34-2

CHF 337.10 – CHF 618.50

Custom/Bulk Quote

Pack size available	0.5mg, 1mg

Please select pack size:

Pack size available

Clear

Add to your inquiry

Product Description

Copeptin (CT-proAVP) is initially produced in equimolar amounts to (Arg⁸)-Vasopressin (AVP). Due to the high stability of copeptin in plasma and serum its measurement is not affected by the problems, which are associated with the direct measurement of AVP, and thus, is suitable to indirectly determine the release of AVP. Copeptin has emerged as a prognostic marker in a variety of diseases, such as sepsis, community-acquired pneumonia, chronic obstructive pulmonary failure, heart failure and myocardial infarction.

ADS

ADS lookup

MSDS

MSDS lookup

Osmotically induced synthesis of the dipeptide N-acetylglutaminylglutamine amide is mediated by a new pathway conserved among bacteria.

B.Sagot et al., Proc. Natl. Acad. Sci. USA, 107, 12652 (2010)

Copeptin, a novel prognostic biomarker in ventilator-associated pneumonia.

R.Seligman et al., Crit. Care, 12, R11 (2008)

Changes in plasma copeptin, the c-terminal portion of arginine vasopressin during water deprivation and excess in healthy subjects.

G.Szinnai et al., J. Clin. Endocrinol. Metab., 92, 3973 (2007)

Copeptin, a stable peptide derived from the vasopressin precursor, is elevated in serum of sepsis patients.

J.Struck et al., Peptides, 26, 2500 (2005)

Assay for the measurement of copeptin, a stable peptide derived from the precursor of vasopressin.

N.G.Morgenthaler et al., Clin. Chem., 52, 112 (2006)

Copeptin: a new and promising diagnostic and prognostic marker.

M.Katan et al., Crit. Care, 12, 117 (2008)

Salt form: Trifluoroacetate

Molecular weight: 4021.46

Chemical Formula: C₁₇₇H₂₇₉N₄₉O₅₈

Storage Temperature: < -15°C

One Letter code: ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY

Source: Synthetic

Old Product Number: H-6718

Country

Inquiry List