(Glu¹⁷·²¹·²⁴)-Osteocalcin (1-49) (human)

H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH (Disulfide bond)

Placeholder

Product Number: 4063516

CAS Number: 1927927-11-4

 82.40 524.30

Pack size available

0.1mg, 0.5mg, 1mg

Please select pack size:

Product Description

The peptide hormone osteocalcin is involved not only in bone formation, it also plays an important role in glucose metabolism and could regulate testosteron. In mice, only the completely decarboxylated form of the peptide shows the latter hormonal activities, whereas in humans, osteocalcin, partially decarboxylated osteocalcins, and the uncarboxylated peptide seem to be involved. Generally, obese individuals have been shown to have lower osteocalcin(s) levels than non-obese controls, and type 2 diabetic individuals have lower plasma osteocalcin than non-diabetic individuals.

Salt form: Trifluoroacetate

Molecular weight: 5797.49

Chemical Formula: C₂₆₆H₃₈₁N₆₇O₇₆S₂

Storage Temperature: < -15°C

Synonyms: Osteocalcin (1-49) (human) (decarboxylated)

One Letter code: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Source: Synthetic

Old Product Number: H-7534

Country

Inquiry List

No products in the list