Stichodactyla helianthus Neurotoxin (ShK)

H-Arg-Ser-Cys-Ile-Asp-Thr-Ile-Pro-Lys-Ser-Arg-Cys-Thr-Ala-Phe-Gln-Cys-Lys-His-Ser-Met-Lys-Tyr-Arg-Leu-Ser-Phe-Cys-Arg-Lys-Thr-Cys-Gly-Thr-Cys-OH (Disulfide bonds between Cys³ and Cys³⁵/Cys¹² and Cys²⁸/Cys¹⁷ and Cys³²)

Product Number: 4031286

CAS Number: 172450-46-3

€ 201.20 – € 1,338.60

Custom/Bulk Quote
Pack size available

0.1mg, 0.5mg, 1mg
Please select pack size:
Add to your inquiry

Product Description

ShK-toxin, originally isolated from the sea anemone Stichodactyla helianthus, has been found to inhibit the specific binding of dendrotoxin I to rat brain membranes. Due to its unique structure (it contains three intramolecular disulfide bridges) and high affinity for some potassium channels, ShK-toxin may become a useful molecular probe for investigating potassium channels.

ADS
Example ADS
ADS lookup
ADS Lookup
MSDS
MSDS
MSDS lookup
MSDS Lookup
Specific high affinity binding sites for somatostatin-28 on pancreatic beta-cells: differences with brain somatostatin receptors.

J.-C.Reubi et al., Endocrinology, 110, 1049 (1982)

Solution structure of ShK toxin, a novel potassium channel inhibitor from a sea anemone.

J.E.Tudor et al., Nat. Struct. Biol., 3, 317 (1996)

Ionisation behaviour and solution properties of the potassium-channel blocker ShK toxin.

J.E.Tudor et al., Eur. J. Biochem., 251, 133 (1998)

An essential binding surface for ShK toxin interaction with rat brain potassium channels.

M.W.Pennington et al., Peptides: Chemistry, Structure and Biology, p. 192, P.T.P.Kaumaya and R.S.Hodges, eds., Mayflower Scientific Ltd., (1996)

Identification of three separate binding sites on SHK toxin, a potent inhibitor of voltage-dependent potassium channels in human T-lymphocytes and rat brain.

M.W.Pennington et al., Biochemistry, 35, 16407 (1996)

0

M.W.Pennington et al., Biochem. Biophys. Res. Commun., 219, 696 (1996)

M.W.Pennington et al., A Guidebook to Protein Toxins and their Use in Cell Biology, p. 159, C.Montecucco and R.Rappuoli, eds., Oxford University Press, (1997)

J.Pohl et al., Lett. Pept. Sci., 1, 291 (1994)

M.D.Lanigan et al., Biochemistry, 40, 15528 (2001)

W.R.Kem et al., Lett. Pept. Sci., 3, 69 (1996)

Salt form: Trifluoroacetate

Molecular weight: 4054.83

Chemical Formula: C₁₆₉H₂₇₄N₅₄O₄₈S₇

Storage Temperature: < -15°C

Synonyms: ShK

One Letter code: RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC

Source: Synthetic

Old Product Number: H-2358

Country

Inquiry List

No products in the list

Discounts

SPECIAL
OFFERS

FAQ's

FAQs

ADS lookup

ADS Lookup

MSDS lookup

MSDS Lookup

Knowledge Center

Knowledge
Center