GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)

H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂

Placeholder

Product Number: 4030663

CAS Number: 107444-51-9

CHF 263CHF 473

Pack size available

0.5mg, 1mg

Please select pack size:
Clear

Product Description

GLP-1 (7-36) amide is secreted from the lower small intestine and shows a strong insulinotropic effect. GLP-1 (7-36) amide is considered as the most important incretin hormone. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. Considerable interest has focused on the development of this peptide as a therapeutic strategy for non-insulin-dependent (type 2 ) diabetes mellitus and associated neuropathy.

M.A.Nauck et al., Exp. Clin. Endocrinol. Diabetes, 105, 187 (1997)

P.A.Martin and A.Faulkner, Comp. Biochem. Physiol. Comp. Physiol., 105, 705 (1993)

B.Kreymann et al., Lancet, 2, 1300 (1987)

T.Perry and N.H.Greig, Trends Pharmacol. Sci., 24, 377 (2003)

Salt form: Trifluoroacetate

Molecular weight: 3297.68

Chemical Formula: C₁₄₉H₂₂₆N₄₀O₄₅

Storage Temperature: < -15°C

Synonyms: Preproglucagon (98-127) amide (human, bovine, guinea pig, mouse, rat)

One Letter code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂

Source: Synthetic

Old Product Number: H-6795

Country

Inquiry List

No products in the list