Gastric Inhibitory Polypeptide (1-30) amide (porcine)
ACF
| ID | 68 |
| key | field_611d2aa11d79c |
| label | Sequence |
| name | sequence_ |
| prefix | acf |
| type | text |
| value | H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH₂ |
| menu_order | 1 |
| required | 0 |
| conditional_logic | 0 |
| parent | 67 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| _name | sequence_ |
| _valid | 1 |
Module Settings
| custom_identifier | ACF Item |
| acf_name | field_611d2aa11d79c |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | off |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | DM - Sequence |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_text_color | #2d7abf |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {"gcid-f71e32a6-6d24-4beb-adc3-f38b1f4074ed":["title_css_text_color"]} |
H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH₂
Execution time: 0.0019 seconds
ACF
| ID | 1523 |
| key | field_612b94055efd3 |
| label | SKU-Product-No |
| name | sku-product-no |
| prefix | acf |
| type | text |
| value | 4030659 |
| menu_order | 3 |
| required | 0 |
| conditional_logic | 0 |
| parent | 67 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| _name | sku-product-no |
| _valid | 1 |
Module Settings
| custom_identifier | ACF Item |
| acf_name | field_612b94055efd3 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| custom_label | Product Number |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | DM - Product No. |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||5px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {} |
Product Number: 4030659
Execution time: 0.0011 seconds
ACF
| ID | 69 |
| key | field_611d2ada1d79d |
| label | CAS Number |
| name | cas_number |
| prefix | acf |
| type | text |
| value | 134846-93-8 |
| menu_order | 2 |
| required | 0 |
| conditional_logic | 0 |
| parent | 67 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| _name | cas_number |
| _valid | 1 |
Module Settings
| custom_identifier | ACF Item |
| acf_name | field_611d2ada1d79d |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | DM - Cas Number |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||5px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {} |
CAS Number: 134846-93-8
Execution time: 0.0010 seconds
$ 296.93 – $ 534.47Price range: $ 296.93 through $ 534.47
| Pack size available | 0.5mg, 1mg |
|---|
Execution time: 0.0006 seconds
Please select pack size:
Product Description
This GIP fragment has potent insulinotropic activity in the isolated, perfused rat pancreas but greatly reduced somatostatinotropic activity in the isolated perfused rat stomach. The site responsible for insulinotropic activity apparently lies between residues 19 and 30 of GIP.
ACF
| ID | 438 |
| key | field_6125071b6e694 |
| label | ADS Lookup |
| name | ads_lookup |
| prefix | acf |
| type | url |
| value | https://ads-pub.bachem.com/QCRFADSPublisher/ADS/StreamADS?key0=4030659.0500&key1=1000037990 |
| menu_order | 1 |
| required | 0 |
| conditional_logic | 0 |
| parent | 436 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| placeholder | ADS Lookup Url. |
| _name | ads_lookup |
| _valid | 1 |
Module Settings
| custom_identifier | Example ADS |
| acf_name | field_6125071b6e694 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | |
| custom_label | Example ADS |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| image | https://shop.bachem.com/wp-content/uploads/2021/09/ICON_ADS-Blue_RGB.png |
| alt | ADS |
| icon_image_placement | top |
| image_max_width | 30% |
| image_mobile_stacking | column |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | on |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | on |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| button_alignment | center |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_text_align | center |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| text_orientation | center |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||20px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {} |
Execution time: 0.0018 seconds
ACF
| ID | 247951 |
| key | field_61a0c2334b2b9 |
| label | ADS Search CS |
| name | ads_search |
| prefix | acf |
| type | url |
| value | https://www.bachem.com/products/research-and-specialties/catalog-peptides/analytical-data-sheet-ads/ |
| menu_order | 3 |
| required | 0 |
| conditional_logic | 0 |
| parent | 436 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| _name | ads_search |
| _valid | 1 |
Module Settings
| custom_identifier | ADS search |
| acf_name | field_61a0c2334b2b9 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | |
| custom_label | ADS Lookup |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| image | https://shop.bachem.com/wp-content/uploads/2021/09/ICON_ADS-Blue_RGB.png |
| alt | ADS lookup |
| icon_image_placement | top |
| image_max_width | 30% |
| image_mobile_stacking | column |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | on |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | on |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| button_alignment | center |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | ADS - Search |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_text_align | center |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_text_align | center |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| text_orientation | center |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||20px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {} |
Execution time: 0.0010 seconds
ACF
| ID | 439 |
| key | field_612507456e695 |
| label | MSDS Lookup |
| name | msds_lookup_ |
| prefix | acf |
| type | url |
| value | https://msds.bachem.com/MSDSSearch/servlet/ext/StreamExtPDF?pdf=4030659 |
| menu_order | 0 |
| required | 0 |
| conditional_logic | 0 |
| parent | 436 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| placeholder | MSDS Lookup Url. |
| _name | msds_lookup_ |
| _valid | 1 |
Module Settings
| custom_identifier | MSDS |
| acf_name | field_612507456e695 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | |
| custom_label | MSDS |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| image | https://shop.bachem.com/wp-content/uploads/2021/09/ICON_MSDS-Blue_RGB.png |
| alt | MSDS |
| icon_image_placement | top |
| image_max_width | 30% |
| image_mobile_stacking | column |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | on |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | on |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| button_alignment | center |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | MSDS - lookup |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_text_align | center |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_text_align | center |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| text_orientation | center |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||20px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {} |
Execution time: 0.0010 seconds
ACF
| ID | 247950 |
| key | field_61a0c20f4b2b8 |
| label | MSDS Search CS |
| name | msds_search |
| prefix | acf |
| type | url |
| value | https://www.bachem.com/products/research-and-specialties/catalog-peptides/msds-material-safety-data-sheet/ |
| menu_order | 2 |
| required | 0 |
| conditional_logic | 0 |
| parent | 436 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| _name | msds_search |
| _valid | 1 |
Module Settings
| custom_identifier | MSDS search |
| acf_name | field_61a0c20f4b2b8 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | |
| custom_label | MSDS Lookup |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| image | https://shop.bachem.com/wp-content/uploads/2021/09/ICON_MSDS-Blue_RGB.png |
| alt | MSDS lookup |
| icon_image_placement | top |
| image_max_width | 30% |
| image_mobile_stacking | column |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | on |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | on |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| button_alignment | center |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | MSDS - search |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_text_align | center |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_text_align | center |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| text_orientation | center |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||20px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {} |
Execution time: 0.0015 seconds
ACF
| ID | 232542 |
| key | field_6177d326319a1 |
| label | Brochure Link |
| name | brochure_0_brochure_link |
| prefix | acf |
| type | url |
| value | https://www.bachem.com/knowledge-center/white-papers/diabetes-peptides/ |
| menu_order | 1 |
| required | 0 |
| conditional_logic | 0 |
| parent | 232540 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| _name | brochure_link |
| _valid | 1 |
| parent_repeater | field_6177d3262eee2 |
Module Settings
| custom_identifier | ACF Item |
| acf_name | field_6177d326319a1 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | h4 |
| show_label | off |
| label_seperator | : |
| suffix | |
| visibility | on |
| empty_value_option | hide_parent_section |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | url |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | list |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | on |
| link_name_acf_name | field_6177d32631968 |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | on |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | field_6177d32631968 |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| disabled_on | off|off|off |
| admin_label | .ACF Item - Brochure link With Title |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |700||||||| |
| label_css_text_color | #004080 |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | |20px|||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| custom_css_main_element | display: inline-block; |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| locked | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["label_css_text_color"],"gcid-f71e32a6-6d24-4beb-adc3-f38b1f4074ed":["label_css_text_color__hover"]} |
| label_css_text_color__hover_enabled | on|desktop |
| label_css_text_color__hover | #2d7abf |
Execution time: 0.0011 seconds
ACF
| ID | 265759 |
| key | field_61e06583839c2 |
| label | Link |
| name | literature_0_lit_link |
| prefix | acf |
| type | url |
| value | http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=8059006 |
| menu_order | 1 |
| required | 0 |
| conditional_logic | 0 |
| parent | 265757 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| _name | lit_link |
| _valid | 1 |
| parent_repeater | field_61e064a3839bf |
Module Settings
| custom_identifier | ACF Item |
| acf_name | field_61e06583839c2 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | h4 |
| show_label | off |
| label_seperator | : |
| suffix | |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | url |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | list |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | on |
| link_name_acf_name | field_61e064f3839c0 |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | on |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | field_61e064f3839c0 |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| disabled_on | off|off|off |
| admin_label | .ACF Item - Literature link With Title |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |700||||||| |
| label_css_text_color | #004080 |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | |20px|||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| custom_css_main_element | display: inline-block; |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| locked | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["label_css_text_color"],"gcid-f71e32a6-6d24-4beb-adc3-f38b1f4074ed":["label_css_text_color__hover"]} |
| label_css_text_color__hover_enabled | on|desktop |
| label_css_text_color__hover | #2d7abf |
Execution time: 0.0015 seconds
ACF
| ID | 265760 |
| key | field_61e06598839c3 |
| label | Gesamt |
| name | literature_0_lit_gesamt |
| prefix | acf |
| type | text |
| value | M.Bryer-Ash et al., Regul. Pept., 51, 101 (1994) |
| menu_order | 2 |
| required | 0 |
| conditional_logic | 0 |
| parent | 265757 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| _name | lit_gesamt |
| _valid | 1 |
| parent_repeater | field_61e064a3839bf |
Module Settings
| custom_identifier | ACF Item |
| acf_name | field_61e06598839c3 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | off |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | label |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | .ACF Item - Gesamt |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_margin | |10px|||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| custom_css_main_element | display: inline-block; |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {} |
M.Bryer-Ash et al., Regul. Pept., 51, 101 (1994)
Execution time: 0.0008 seconds
ACF
| ID | 427 |
| key | field_6125054f3b2a2 |
| label | Salt form |
| name | salt_form |
| prefix | acf |
| type | text |
| value | Trifluoroacetate |
| menu_order | 0 |
| required | 0 |
| conditional_logic | 0 |
| parent | 426 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| placeholder | Salt form |
| _name | salt_form |
| _valid | 1 |
Module Settings
| custom_identifier | Salt Form |
| acf_name | field_6125054f3b2a2 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | .ACF Item -Salt Form |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font | |||||||| |
| title_css_text_color | #004080 |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |||||||| |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||8px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color"]} |
Salt form: Trifluoroacetate
Execution time: 0.0017 seconds
ACF
| ID | 428 |
| key | field_6125059a3b2a3 |
| label | Molecular weight |
| name | molecular_weight |
| prefix | acf |
| type | range |
| value | 3551.04 |
| menu_order | 1 |
| required | 0 |
| conditional_logic | 0 |
| parent | 426 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| min | 0 |
| max | 31629 |
| step | .01 |
| _name | molecular_weight |
| _valid | 1 |
Module Settings
| custom_identifier | Mole wg |
| acf_name | field_6125059a3b2a3 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | .ACF Item -Mole weight |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font | |||||||| |
| title_css_text_color | #004080 |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |||||||| |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||8px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Molecular weight: 3551.04
Execution time: 0.0016 seconds
ACF
| ID | 429 |
| key | field_612505b63b2a4 |
| label | Sum Formula |
| name | sum_formula |
| prefix | acf |
| type | text |
| value | C₁₆₂H₂₄₅N₄₁O₄₇S |
| menu_order | 2 |
| required | 0 |
| conditional_logic | 0 |
| parent | 426 |
| wrapper | Array ( [width] => [class] => enbold [id] => ) |
| placeholder | Sum Formula |
| _name | sum_formula |
| _valid | 1 |
Module Settings
| custom_identifier | Sum Formula |
| acf_name | field_612505b63b2a4 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| custom_label | Chemical Formula |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | .ACF Item -Sum Formula |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font | |||||||| |
| title_css_text_color | #004080 |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |||||||| |
| label_css_letter_spacing | 0px |
| text_before_css_font | |||||||| |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font | |||||||| |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||8px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Chemical Formula: C₁₆₂H₂₄₅N₄₁O₄₇S
Execution time: 0.0016 seconds
ACF
| ID | 430 |
| key | field_612505e03b2a5 |
| label | Storage Temperature |
| name | storage_temperature |
| prefix | acf |
| type | text |
| value | < -15°C |
| menu_order | 3 |
| required | 0 |
| conditional_logic | 0 |
| parent | 426 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| placeholder | Storage Temperature |
| _name | storage_temperature |
| _valid | 1 |
Module Settings
| custom_identifier | Storage Temp |
| acf_name | field_612505e03b2a5 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | .ACF Item -Storage Temp |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font | |||||||| |
| title_css_text_color | #004080 |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |||||||| |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||8px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Storage Temperature: < -15°C
Execution time: 0.0010 seconds
ACF
| ID | 432 |
| key | field_612505fb1608e |
| label | Synonyms |
| name | synonym |
| prefix | acf |
| type | text |
| value | Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine) |
| menu_order | 4 |
| required | 0 |
| conditional_logic | 0 |
| parent | 426 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| placeholder | Synonym |
| _name | synonym |
| _valid | 1 |
Module Settings
| custom_identifier | Synonym |
| acf_name | field_612505fb1608e |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | .ACF Item - Synonym |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font | |||||||| |
| title_css_text_color | #004080 |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |||||||| |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||8px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Synonyms: Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine)
Execution time: 0.0010 seconds
ACF
| ID | 435 |
| key | field_6125064316091 |
| label | One Letter code |
| name | one_letter_code |
| prefix | acf |
| type | text |
| value | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH₂ |
| menu_order | 7 |
| required | 0 |
| conditional_logic | 0 |
| parent | 426 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| placeholder | One Letter code |
| _name | one_letter_code |
| _valid | 1 |
Module Settings
| custom_identifier | One Letter code |
| acf_name | field_6125064316091 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | .ACF Item - One Letter code |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font | |||||||| |
| title_css_text_color | #004080 |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |||||||| |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||8px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
One Letter code: YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH₂
Execution time: 0.0009 seconds
ACF
| ID | 433 |
| key | field_612506121608f |
| label | Source |
| name | source |
| prefix | acf |
| type | text |
| value | Synthetic |
| menu_order | 5 |
| required | 0 |
| conditional_logic | 0 |
| parent | 426 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| placeholder | Source |
| _name | source |
| _valid | 1 |
Module Settings
| custom_identifier | Source |
| acf_name | field_612506121608f |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | .ACF Item - Source |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font | |||||||| |
| title_css_text_color | #004080 |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |||||||| |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||8px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Source: Synthetic
Execution time: 0.0010 seconds
ACF
| ID | 434 |
| key | field_6125062f16090 |
| label | Old Product Number |
| name | old_product_number |
| prefix | acf |
| type | text |
| value | H-3824 |
| menu_order | 6 |
| required | 0 |
| conditional_logic | 0 |
| parent | 426 |
| wrapper | Array ( [width] => [class] => [id] => ) |
| placeholder | Old Product Number |
| _name | old_product_number |
| _valid | 1 |
Module Settings
| custom_identifier | Catalog Number |
| acf_name | field_6125062f16090 |
| is_author_acf_field | off |
| post_object_acf_name | none |
| author_field_type | author_post |
| linked_user_acf_name | none |
| type_taxonomy_acf_name | none |
| acf_tag | p |
| show_label | on |
| label_seperator | : |
| visibility | on |
| empty_value_option | hide_module |
| element_in_section | off |
| use_icon | off |
| icon_color | #2d7abf |
| use_circle | off |
| circle_color | #2d7abf |
| use_circle_border | off |
| circle_border_color | #2d7abf |
| use_icon_font_size | off |
| icon_image_placement | left |
| image_mobile_stacking | initial |
| return_format | array |
| auto_detect_video_audio | on |
| image_link_url | off |
| image_link_url_acf_name | none |
| checkbox_style | array |
| checkbox_radio_return | label |
| checkbox_radio_value_type | off |
| checkbox_radio_link | off |
| link_button | off |
| email_subject | none |
| email_body_after | none |
| add_css_class | off |
| add_css_loop_layout | off |
| add_css_class_selector | body |
| link_new_tab | on |
| link_name_acf | off |
| link_name_acf_name | none |
| url_link_icon | off |
| url_as_image | off |
| image_size | full |
| image_full_width | off |
| true_false_condition | off |
| true_false_condition_css_selector | .et_pb_button |
| true_false_text_true | True |
| is_audio | off |
| use_browser_default_audio_player | off |
| audio_player_background_color | #000 |
| audio_controls_color | #ffffff |
| is_video | off |
| video_keep_aspect_ratio | on |
| video_loop | on |
| video_autoplay | on |
| video_controls | off |
| make_video_background | off |
| video_background_size | cover |
| is_oembed_video | off |
| defer_video | off |
| defer_video_icon | I||divi||400 |
| video_icon_font_size | off |
| pretify_text | off |
| pretify_seperator | , |
| number_decimal | . |
| show_value_if_zero | off |
| text_image | off |
| is_options_page | off |
| is_repeater_loop_layout | off |
| linked_post_style | custom |
| link_post_seperator | , |
| link_to_post_object | on |
| link_to_post_object_new_tab | off |
| loop_layout | none |
| columns | 4 |
| columns_tablet | 2 |
| columns_mobile | 1 |
| user_field_return | display_name |
| link_to_author_page | off |
| repeater_dyn_btn_acf | none |
| text_before_position | same_line |
| label_position | same_line |
| vertical_alignment | middle |
| admin_label | .ACF Item - Old Product Number |
| _builder_version | 4.16 |
| _module_preset | default |
| title_css_font | |||||||| |
| title_css_text_color | #004080 |
| title_css_font_size | 14px |
| title_css_letter_spacing | 0px |
| title_css_line_height | 1em |
| acf_label_css_font_size | 14px |
| acf_label_css_letter_spacing | 0px |
| acf_label_css_line_height | 1em |
| label_css_font | |||||||| |
| label_css_letter_spacing | 0px |
| text_before_css_font_size | 14px |
| text_before_css_letter_spacing | 0px |
| text_before_css_line_height | 1em |
| seperator_font_size | 14px |
| seperator_letter_spacing | 0px |
| seperator_line_height | 1em |
| relational_field_item_font_size | 14px |
| relational_field_item_letter_spacing | 0px |
| relational_field_item_line_height | 1em |
| background_enable_color | on |
| use_background_color_gradient | off |
| background_color_gradient_repeat | off |
| background_color_gradient_type | linear |
| background_color_gradient_direction | 180deg |
| background_color_gradient_direction_radial | center |
| background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| background_color_gradient_unit | % |
| background_color_gradient_overlays_image | off |
| background_color_gradient_start | #2b87da |
| background_color_gradient_start_position | 0% |
| background_color_gradient_end | #29c4a9 |
| background_color_gradient_end_position | 100% |
| background_enable_image | on |
| parallax | off |
| parallax_method | on |
| background_size | cover |
| background_image_width | auto |
| background_image_height | auto |
| background_position | center |
| background_horizontal_offset | 0 |
| background_vertical_offset | 0 |
| background_repeat | no-repeat |
| background_blend | normal |
| background_enable_video_mp4 | on |
| background_enable_video_webm | on |
| allow_player_pause | off |
| background_video_pause_outside_viewport | on |
| background_enable_pattern_style | off |
| background_pattern_style | polka-dots |
| background_pattern_color | rgba(0,0,0,0.2) |
| background_pattern_size | initial |
| background_pattern_width | auto |
| background_pattern_height | auto |
| background_pattern_repeat_origin | top_left |
| background_pattern_horizontal_offset | 0 |
| background_pattern_vertical_offset | 0 |
| background_pattern_repeat | repeat |
| background_pattern_blend_mode | normal |
| background_enable_mask_style | off |
| background_mask_style | layer-blob |
| background_mask_color | #ffffff |
| background_mask_aspect_ratio | landscape |
| background_mask_size | stretch |
| background_mask_width | auto |
| background_mask_height | auto |
| background_mask_position | center |
| background_mask_horizontal_offset | 0 |
| background_mask_vertical_offset | 0 |
| background_mask_blend_mode | normal |
| custom_button | off |
| button_text_size | 14 |
| button_bg_use_color_gradient | off |
| button_bg_color_gradient_repeat | off |
| button_bg_color_gradient_type | linear |
| button_bg_color_gradient_direction | 180deg |
| button_bg_color_gradient_direction_radial | center |
| button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
| button_bg_color_gradient_unit | % |
| button_bg_color_gradient_overlays_image | off |
| button_bg_color_gradient_start | #2b87da |
| button_bg_color_gradient_start_position | 0% |
| button_bg_color_gradient_end | #29c4a9 |
| button_bg_color_gradient_end_position | 100% |
| button_bg_enable_image | on |
| button_bg_parallax | off |
| button_bg_parallax_method | on |
| button_bg_size | cover |
| button_bg_image_width | auto |
| button_bg_image_height | auto |
| button_bg_position | center |
| button_bg_horizontal_offset | 0 |
| button_bg_vertical_offset | 0 |
| button_bg_repeat | no-repeat |
| button_bg_blend | normal |
| button_bg_enable_video_mp4 | on |
| button_bg_enable_video_webm | on |
| button_bg_allow_player_pause | off |
| button_bg_video_pause_outside_viewport | on |
| button_use_icon | on |
| button_icon_placement | right |
| button_on_hover | on |
| positioning | none |
| position_origin_a | top_left |
| position_origin_f | top_left |
| position_origin_r | top_left |
| width | auto |
| max_width | none |
| min_height | auto |
| height | auto |
| max_height | none |
| custom_padding | ||8px||false|false |
| filter_hue_rotate | 0deg |
| filter_saturate | 100% |
| filter_brightness | 100% |
| filter_contrast | 100% |
| filter_invert | 0% |
| filter_sepia | 0% |
| filter_opacity | 100% |
| filter_blur | 0px |
| mix_blend_mode | normal |
| animation_style | none |
| animation_direction | center |
| animation_duration | 1000ms |
| animation_delay | 0ms |
| animation_intensity_slide | 50% |
| animation_intensity_zoom | 50% |
| animation_intensity_flip | 50% |
| animation_intensity_fold | 50% |
| animation_intensity_roll | 50% |
| animation_starting_opacity | 0% |
| animation_speed_curve | ease-in-out |
| animation_repeat | once |
| hover_transition_duration | 300ms |
| hover_transition_delay | 0ms |
| hover_transition_speed_curve | ease |
| link_option_url_new_window | off |
| sticky_position | none |
| sticky_offset_top | 0px |
| sticky_offset_bottom | 0px |
| sticky_limit_top | none |
| sticky_limit_bottom | none |
| sticky_offset_surrounding | on |
| sticky_transition | on |
| motion_trigger_start | middle |
| hover_enabled | 0 |
| title_css_text_shadow_style | none |
| title_css_text_shadow_horizontal_length | 0em |
| title_css_text_shadow_vertical_length | 0em |
| title_css_text_shadow_blur_strength | 0em |
| title_css_text_shadow_color | rgba(0,0,0,0.4) |
| acf_label_css_text_shadow_style | none |
| acf_label_css_text_shadow_horizontal_length | 0em |
| acf_label_css_text_shadow_vertical_length | 0em |
| acf_label_css_text_shadow_blur_strength | 0em |
| acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
| label_css_text_shadow_style | none |
| label_css_text_shadow_horizontal_length | 0em |
| label_css_text_shadow_vertical_length | 0em |
| label_css_text_shadow_blur_strength | 0em |
| label_css_text_shadow_color | rgba(0,0,0,0.4) |
| text_before_css_text_shadow_style | none |
| text_before_css_text_shadow_horizontal_length | 0em |
| text_before_css_text_shadow_vertical_length | 0em |
| text_before_css_text_shadow_blur_strength | 0em |
| text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
| seperator_text_shadow_style | none |
| seperator_text_shadow_horizontal_length | 0em |
| seperator_text_shadow_vertical_length | 0em |
| seperator_text_shadow_blur_strength | 0em |
| seperator_text_shadow_color | rgba(0,0,0,0.4) |
| relational_field_item_text_shadow_style | none |
| relational_field_item_text_shadow_horizontal_length | 0em |
| relational_field_item_text_shadow_vertical_length | 0em |
| relational_field_item_text_shadow_blur_strength | 0em |
| relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
| button_text_shadow_style | none |
| button_text_shadow_horizontal_length | 0em |
| button_text_shadow_vertical_length | 0em |
| button_text_shadow_blur_strength | 0em |
| button_text_shadow_color | rgba(0,0,0,0.4) |
| box_shadow_style | none |
| box_shadow_color | rgba(0,0,0,0.3) |
| box_shadow_position | outer |
| box_shadow_style_audio | none |
| box_shadow_color_audio | rgba(0,0,0,0.3) |
| box_shadow_position_audio | outer |
| box_shadow_style_button | none |
| box_shadow_color_button | rgba(0,0,0,0.3) |
| box_shadow_position_button | outer |
| text_shadow_style | none |
| text_shadow_horizontal_length | 0em |
| text_shadow_vertical_length | 0em |
| text_shadow_blur_strength | 0em |
| text_shadow_color | rgba(0,0,0,0.4) |
| disabled | off |
| global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Old Product Number: H-3824
Execution time: 0.0009 seconds
Country
Inquiry List
No products in the list
