D.H.Coy et al., Peptides, Chemistry, Structure and Biology, Proceedings of the 11th American Peptide Symposium, La Jolla, p. 65, J.E.Rivier and G.R.Marshall, eds., Escom, Leiden, (1990)
Salt form: Trifluoroacetate
Molecular weight: 3399.88
Chemical Formula: C₁₄₈H₂₂₈N₄₀O₄₆S₃
Storage Temperature: < -15°C
One Letter code: CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH₂
Cookie Settings We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our Privacy Policy
Functional
Always active
The technical storage or access is strictly necessary for the legitimate purpose of enabling the use of a specific service explicitly requested by the subscriber or user, or for the sole purpose of carrying out the transmission of a communication over an electronic communications network.
Preferences
The technical storage or access is necessary for the legitimate purpose of storing preferences that are not requested by the subscriber or user.
Statistics
The technical storage or access that is used exclusively for statistical purposes.The technical storage or access that is used exclusively for anonymous statistical purposes. Without a subpoena, voluntary compliance on the part of your Internet Service Provider, or additional records from a third party, information stored or retrieved for this purpose alone cannot usually be used to identify you.
Marketing
The technical storage or access is required to create user profiles to send advertising, or to track the user on a website or across several websites for similar marketing purposes.