ω-Agatoxin IVa

H-Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala-OH (Disulfide bonds between Cys⁴ and Cys²⁰/Cys¹² and Cys²⁵/Cys¹⁹ and Cys³⁶/Cys²⁷ and Cys³⁴)

Placeholder

Product Number: 4030173

CAS Number: 145017-83-0

 312.40 1,873.60

Pack size available

0.1mg, 1mg

Please select pack size:

Product Description

ω-Agatoxin IVa is a peptide isolated from the venom of the American funnel web spider, Agelenopsis aperta. ω-Aga IVa is a selective and potent blocker of the mammalian P-type voltage-dependent calcium channel.

D.Phillips et al., U.S.Patent No. 5,122,596, (1992)

H.Nishio et al., Peptides, Chemistry, Structure and Biology, Proceedings of the 13th American Peptide Symposium, Edmonton, Alberta, Canada, p. 31, R.S.Hodges and J.A.Smith, eds., Escom, Leiden, (1994)

Salt form: Trifluoroacetate

Molecular weight: 5202.33

Chemical Formula: C₂₁₇H₃₆₀N₆₈O₆₀S₁₀

Storage Temperature: < -15°C

One Letter code: KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Source: Synthetic

Old Product Number: H-1544

Country

Inquiry List

No products in the list