BNP-32 (human)

H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide bond)

Placeholder

Product Number: 4016567

CAS Number: 124584-08-3

CHF 506.10 – CHF 898.80

Custom/Bulk Quote
Pack size available

0.5mg, 1mg
Please select pack size:
Add to your inquiry

Product Description

The secretion of the cardiac hormone BNP-32 is increased considerably in patients with congestive heart failure, successful medical treatment of this condition will result in a decrease. Yandle et al. described a method for determining hBNP in human plasma. Effects of hBNP infusion in humans have been described by Holmes et al and La Villa et al. BNP is an important biomarker in the diagnosis of heart diseases. Additionally, BNP-32 may act as a neuropeptide. BNP-32 exerts strong lipolytic effects in humans.

ADS
Example ADS
ADS lookup
ADS Lookup
MSDS
MSDS
MSDS lookup
MSDS Lookup
Selective Binding of the Dipeptides L-Phe-D-Pro and D-Phe-L-Pro to β-Cyclodextrin.

M.Maletic et al., Angew. Chem. Int. Ed. Engl., 35, 1490 (1996)

Histamine release induced by human natriuretic peptide from rat peritoneal mast cells.

H.Yoshida et al., Regul. Pept., 61, 45 (1996)

Assay of brain natriuretic peptide (BNP) in human plasma: evidence for high molecular weight BNP as a major plasma component in heart failure.

T.G.Yandle et al., J. Clin. Endocrinol. Metab., 76, 832 (1993)

BNP as a biomarker in heart disease.

O.Vuolteenaho et al., Adv. Clin. Chem., 40, 1 (2005)

Natriuretic peptides: a new lipolytic pathway in human adipocytes.

C.Sengenes et al., FASEB J., 14, 1345 (2000)

Cardiovascular and renal effects of low dose brain natriuretic peptide infusion in man.

G.La Villa et al., J. Clin. Endocrinol. Metab., 78, 1166 (1994)

Renal, endocrine, and hemodynamic effects of human brain natriuretic peptide in normal man.

S.J.Holmes et al., J. Clin. Endocrinol. Metab., 76, 91 (1993)

Histamine release induced by human natriuretic peptide from rat peritoneal mast cells.

H.Yoshida et al., Regul. Pept., 61, 45 (1996)

Assay of brain natriuretic peptide (BNP) in human plasma: evidence for high molecular weight BNP as a major plasma component in heart failure.

T.G.Yandle et al., J. Clin. Endocrinol. Metab., 76, 832 (1993)

BNP as a biomarker in heart disease.

O.Vuolteenaho et al., Adv. Clin. Chem., 40, 1 (2005)

Natriuretic peptides: a new lipolytic pathway in human adipocytes.

C.Sengenes et al., FASEB J., 14, 1345 (2000)

Salt form: Acetate

Molecular weight: 3464.09

Chemical Formula: C₁₄₃H₂₄₄N₅₀O₄₂S₄

Storage Temperature: < -15°C

Synonyms: Nesiritide

One Letter code: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Source: Synthetic

Old Product Number: H-9060

Country

Inquiry List

No products in the list

Discounts

SPECIAL
OFFERS

FAQ's

FAQs

ADS lookup

ADS Lookup

MSDS lookup

MSDS Lookup

Knowledge Center

Knowledge
Center