Amyloid β-Protein (1-40)

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

Placeholder

Product Number: 4014442

CAS Number: 131438-79-4

 78.10 1,121.40

Pack size available

0.1mg, 0.5mg, 1mg, 5mg

Please select pack size:

Product Description

Amyloid β-peptide (1-40) showed both neurotrophic and neurotoxic effects in dependence on the neuronal age and the concentration of the β-protein. Aβ 1-40 has been used as well as Aβ 1-42 to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer’s disease patients. The sequence of this peptide corresponds to the sequence of human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ40. The inverted sequence can be used as inactive control in experiments employing Aβ 1-40. For detailed descriptions of the preparation of wild-type and mutant Aβ 1-40 monomers and protofibrils please see the paper of Jan, Hartley, and Lashuel.

Salt form: Trifluoroacetate

Molecular weight: 4329.86

Chemical Formula: C₁₉₄H₂₉₅N₅₃O₅₈S

Storage Temperature: < -15°C

Synonyms: Aβ40 trifluoroacetate salt

One Letter code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Source: Synthetic

Old Product Number: H-1194

Country

Inquiry List

No products in the list