pTH (1-34) (human)

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

Placeholder

Product Number: 4011474

CAS Number: 52232-67-4

CHF 224.70 – CHF 898.80

Custom/Bulk Quote
Pack size available

1mg, 5mg
Please select pack size:
Add to your inquiry

Product Description

Teriparatide, which consists of the N-terminal 34 amino acid residues of parathyroid hormone, shows the same potency and pharmacological profile as the native hormone. Administration of teriparatide stimulates bone formation and increases the bone mineral density (BMD).

ADS
Example ADS
ADS lookup
ADS Lookup
MSDS
MSDS
MSDS lookup
MSDS Lookup
Peptides In Veterinary Peptides Medicine
Physiological and behavioral responses to corticotropin-releasing factor administration: is CRF a mediator of anxiety or stress responses?

R.J.Dunn and C.W.Berridge, Brain Res. Brain Res. Rev., 15, 71 (1990)

Effects of parathyroid hormone on newly regenerated bone during distraction osteogenesis in a rabbit tibial lengthening model. A pilot study.

R.Aleksyniene et al., Medicina (Kaunas), 42, 38 (2006)

Teriparatide and osseous regeneration in the oral cavity.

J.D.Bashutski et al., N. Engl. J. Med., 363, 2396 (2010)

Treatment of osteoporosis with human parathyroid peptide and observations on effect of sodium fluoride.

J.Reeve et al., Br. Med. J., 301, 314 (1990)

Anabolic actions of PTH (1-34): use of a novel tissue engineering model to investigate temporal effects on bone.

G.J.Pettway et al., Bone, 36, 959 (2005)

Effects of two treatment regimes with synthetic human parathyroid hormone fragment on bone formation and the tissue balance of trabecular bone in greyhounds.

R.Podbesek et al., Endocrinology, 112, 1000 (1983)

Structure and protein kinase C stimulating activities of lactam analogues of human parathyroid hormone fragment.

W.Neugebauer et al., Int. J. Pept. Protein Res., 43, 555 (1994)

Synthetic peptides as tools for investigating the pathogenicity of disease: humoral hypercalcemia of malignancy.

R.L.McKee and M.P.Caulfield, Pept. Res., 2, 161 (1989)

Two-dimensional 1H-NMR study of the 1-34 fragment of human parathyroid hormone.

S.C.Lee and A.F.Russell, Biopolymers, 28, 1115 (1989)

Human parathyroid hormone (1-34) accelerates the fracture healing process of woven to lamellar bone replacement and new cortical shell formation in rat femora.

S.Komatsubara et al., Bone, 36, 678 (2005)

Pharmacokinetics of synthetic human parathyroid hormone 1-34 in man measured by cytochemical bioassay and radioimmunoassay.

G.N.Kent et al., Clin. Sci., 68, 171 (1985)

Salt form: Acetate

Molecular weight: 4117.77

Chemical Formula: C₁₈₁H₂₉₁N₅₅O₅₁S₂

Storage Temperature: < -15°C

Synonyms: Parathyroid Hormone (1-34), human

One Letter code: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Source: Synthetic

Old Product Number: H-4835

Country

Inquiry List

No products in the list

Discounts

SPECIAL
OFFERS

FAQ's

FAQs

ADS lookup

ADS Lookup

MSDS lookup

MSDS Lookup

Knowledge Center

Knowledge
Center