CRF (human, rat)

H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH₂

Placeholder

Product Number: 4011473

CAS Number: 86784-80-7

CHF 337.10CHF 1,349.30

Pack size available

1mg, 5mg

Please select pack size:

Product Description

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.

M.L.Vance, Clin. Chem., 36, 415 (1990)

L.Arborelius et al., J. Endocrinol., 160, 1 (1999)

Salt form: Acetate

Molecular weight: 4757.52

Chemical Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

Storage Temperature: < -15°C

Synonyms: Corticorelin

One Letter code: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH₂

Source: Synthetic

Old Product Number: H-2435

Country

Inquiry List

No products in the list