×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
4094738

Availability: In stock

(Des-Lys³⁸)-M65 trifluoroacetate salt
H-Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Glu-Phe-Lys-Ala-NH₂ trifluoroacetate salt (Disulfide bonds between Cys¹ and Cys⁵/Cys¹⁴ and Cys³²)

4094738

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4094738.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 357.00
CHF 332.01 (7%)
4094738.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 663.00
CHF 616.59 (7%)
Catalog Number H-7538
One Letter Code CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKEFKA-NH₂
Synonyms (Des-Lys³⁸)-PAC1 Receptor Antagonist M65
Molecular Formula C₁₉₉H₃₁₄N₆₂O₆₀S₅
Relative Molecular Mass 4695.39
CAS Registry Number 1816939-38-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Links / Documents:
Brochures: