Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
4031157

Availability: In stock

PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ trifluoroacetate salt

4031157

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4031157.0200 0.2 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 166.00
CHF 154.38 (7%)
4031157.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)
4031157.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 662.00
CHF 615.66 (7%)

Details

Kojro et al. observed that the PAC1 agonists PACAP-27 (H-1172) and PACAP-38 strongly increased the activity of α-secretase. Upregulation of this APP-degrading enzyme promotes the non-amyloidogenic processing of APP, i.e. reduces the production of Aβ40/42, and thus may help to prevent Alzheimer’s disease. Nasally applied PACAP-38 in APP[V717I]-transgenic mice additionally enhanced the production of the Aβ-degrading enzyme neprilysin via induction of somatostatin.
Catalog Number H-8430
APC Number 34-0-20
One Letter Code HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
Synonyms Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat), PACAP (1-38), human, ovine, rat
Molecular Formula C₂₀₃H₃₃₁N₆₃O₅₃S
Relative Molecular Mass 4534.32
CAS Registry Number 124123-15-5
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Bachem product citations

C.S.Schitine et al., Neurochem. Int., 82, 42 (2015)
B.Stutz et al., J. Neurochem., 128, 829 (2014)
J.Wojcieszak and J.B.Zawilska, J. Mol. Neurosci., 54, 463 (2014)
G.Zaccone et al., Acta Histochem., 112, 328 (2010)
K.Freson et al., Blood, 111, 1885 (2008)
Q.Jiang et al., Am. J. Physiol. Endocrinol. Metab., 295, E477 (2008)
G.Zaccone et al., Anat. Rec. (Hoboken), 290, 1166 (2007)
M.Rusnak et al., J. Neurosci., 27, 141 (2007)
A.Adamik and G.Telegdy, Regul. Pept., 127, 55 (2005)
D.Ma et al., J. Clin. Invest., 114, 339 (2004)
L.G.Ermilov et al., J. Physiol., 560, 231 (2004)
A.G.Andreolotti et al., Eur. J. Biochem., 270, 4706 (2003)
I.Pataki et al., BMC Neurosci., 3, 2 (2002)
P.Lohrer et al., Neuroendocrinology, 74, 95 (2001)
C.Otto et al., Mech. Dev., 94, 111 (2000)
T.Dickinson et al., Neuropeptides, 31, 175 (1997)
P.J.Deutsch and Y.Sun, J. Biol. Chem., 267, 5108 (1992)

Product citations

D.Rat et al., FASEB J., 25, 3208 (2011)
E.Kojro et al., FASEB J., 20, 512 (2006)
J.Fahrenkrug, Chronobiol. Int., 23, 53 (2006)
D.Vaudry et al., Pharmacol. Rev., 52, 269 (2000)
A.Miyata et al., Biochem. Biophys. Res. Commun., 164, 567 (1989)