×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
4044528

Availability: In stock

GRPP (human) trifluoroacetate salt
H-Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-OH trifluoroacetate salt

4044528

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4044528.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4044528.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 525.00
CHF 488.25 (7%)

Details

GRPP (human) also known as glicentin-related polypeptide (human) is a synthetic analog of a cleavage product resulting from proglucagon processing in pancreatic α- and intestinal L-cells.
Catalog Number H-6062
One Letter Code RSLQDTEEKSRSFSASQADPLSDPDQMNED
Synonyms Glicentin-Related Polypeptide (human), Preproglucagon (21-50) (human), Proglucagon (1-30) (human)
Molecular Formula C₁₃₆H₂₁₅N₄₁O₅₈S
Relative Molecular Mass 3384.51
CAS Registry Number 1132745-52-8
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Diabetes
Links / Documents:
Brochures:

Bachem product citations

L.Whiting et al., Physiol. Rep., 3, 2015 (2015)

Product citations

J.J.Holst, Annu. Rev. Physiol., 59, 257 (1997)
Y.Rouillé et al., FEBS Lett., 413, 119 (1997)