Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

CRF (human, rat) acetate salt
H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH₂ acetate salt


Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4011473.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4011473.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,261.00
CHF 1,172.73 (7%)


CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.
Catalog Number H-2435
APC Number 34-1-10
Synonyms Corticorelin, Corticoliberin, Corticotropin Releasing Factor, human, rat, CRF-41, CRH
Molecular Formula C₂₀₈H₃₄₄N₆₀O₆₃S₂
Relative Molecular Mass 4757.52
CAS Registry Number 86784-80-7
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords ACTH secretagogue involved in stress response

Bachem product citations