×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
4030456

Availability: In stock

Tyr-α-CGRP (human) trifluoroacetate salt
H-Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ trifluoroacetate salt (Disulfide bond)

4030456

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030456.1000 1 mg Ships within 3-5 business days  
CHF 368.00
CHF 342.24 (7%)
Catalog Number H-3354
APC Number 22-1-17
One Letter Code YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH₂
Synonyms [Tyr0] Calcitonin Gene Related Peptide, human, Tyr-CGRP I (human)
Molecular Formula C₁₇₂H₂₇₆N₅₂O₅₁S₂
Relative Molecular Mass 3952.54
CAS Registry Number 124756-98-5
Source Synthetic
Storage Conditions -20 ± 5 °C
Links / Documents:
Brochures: