Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Defensin HNP-3 (human) trifluoroacetate salt
H-Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH trifluoroacetate salt
(Disulfide bonds between Cys² and Cys³⁰/Cys⁴ and Cys¹⁹/Cys⁹ and Cys²⁹)

4025495

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4025495.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 184.00
CHF 171.12 (7%)
4025495.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 551.00
CHF 512.43 (7%)
4025495.1000 1 mg Ships within 3-5 business days  
CHF 1,019.00
CHF 947.67 (7%)
Add to Wish List
Add to Compare
Catalog Number H-9860
One Letter Code DCYCRIPACIAGERRYGTCIYQGRLWAFCC
Synonyms Human Neutrophil Peptide-3, HNP-3
Molecular Formula C₁₅₁H₂₂₂N₄₄O₄₀S₆
Relative Molecular Mass 3486.09
CAS Registry Number [136661-76-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antimicrobial peptide