Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Defensin HNP-1 (human) trifluoroacetate salt
H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH trifluoroacetate salt
(Disulfide bonds between Cys² and Cys³⁰/Cys⁴ and Cys¹⁹/Cys⁹ and Cys²⁹)

4025473

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4025473.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 153.00
CHF 142.29 (7%)
4025473.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 612.00
CHF 569.16 (7%)
4025473.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,173.00
CHF 1,090.89 (7%)
Add to Wish List
Add to Compare
Catalog Number H-9855
APC Number 72-2-10
One Letter Code ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Synonyms Human Neutrophil Peptide-1, HNP-1
Molecular Formula C₁₅₀H₂₂₂N₄₄O₃₈S₆
Relative Molecular Mass 3442.08
CAS Registry Number [148093-65-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antimicrobial peptide