Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Anthopleurin-A
H-Gly-Val-Ser-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Thr-Leu-Trp-Leu-Tyr-Pro-Ser-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln-OH
(Disulfide bonds between Cys⁴ and Cys⁴⁶/Cys⁶ and Cys³⁶/Cys²⁹ and Cys⁴⁷)

4030365

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030365.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 210.00
CHF 195.30 (7%)
4030365.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 840.00
CHF 781.20 (7%)
Add to Wish List
Add to Compare

Details

Anthopleurin-A (AP-A) has been isolated from the sea anemone, Anthopleura xanthogrammica, and was found to have inotropic but no chronotropic effects on mammalian heart preparation.
Catalog Number H-9590
One Letter Code GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ
Molecular Formula C₂₂₀H₃₂₆N₆₄O₆₇S₆
Relative Molecular Mass 5131.80
CAS Registry Number [60880-63-9]
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Sea anemone peptide

Product citations

W.R.Kem et al., Eliat Symposium on Marine Pharmacology, p. 98, P.Lazarovici, ed., Alaken Inc., Ft. Collins, (1996)