Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

trifluoroacetate salt
trifluoroacetate salt

4015593

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4015593.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 210.00
CHF 195.30 (7%)
4015593.1000 1 mg Ships within 3-5 business days  
CHF 357.00
CHF 332.01 (7%)
Add to Wish List
Add to Compare
Catalog Number H-9105
One Letter Code TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL
Synonyms pTH-rP Splice Isoform 3 (140-173) (human), Hypercalcemia of Malignancy Factor Splice Isoform 3 (140-173) (human)
Molecular Formula C₁₈₆H₃₁₃N₅₃O₄₄S₂
Relative Molecular Mass 4059.99
CAS Registry Number [139872-85-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C