Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Echistatin
H-Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr-OH
(Disulfide bonds between Cys² and Cys¹¹/Cys⁷ and Cys³²/Cys⁸ and Cys³⁷/Cys²⁰ and Cys³⁹)

4030571

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030571.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 389.00
CHF 361.77 (7%)
4030571.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,554.00
CHF 1,445.22 (7%)
Add to Wish List
Add to Compare

Details

Echistatin is a 49-amino acid polypeptide from the venom of the saw-scaled viper, Echis carinatus. The peptide containing an RGD motif binds to the glycoprotein IIb/IIIa receptor on the platelet and is a potent competitive inhibitor of ADPstimulated platelet aggregation mediated by fibrinogen and other factors. Furthermore, echistatin effectively inhibits osteoclastic bone resorption in vitro and in vivo.
Catalog Number H-9010
One Letter Code ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Molecular Formula C₂₁₇H₃₄₁N₇₁O₇₄S₉
Relative Molecular Mass 5417.12
CAS Registry Number [154303-05-6]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Hematology
Osteoporosis Research