Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Tau Peptide (244-274) (Repeat 1 Domain) trifluoroacetate salt
H-Gln-Thr-Ala-Pro-Val-Pro-Met-Pro-Asp-Leu-Lys-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-OH trifluoroacetate salt

4099397

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4099397.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 71.00
CHF 66.03 (7%)
4099397.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 122.00
CHF 113.46 (7%)
Add to Wish List
Add to Compare

Details

During heparin-induced self-aggregation of the four repeat domain peptides (R1–R4) excised from tau, R1, which resembles Tau Peptide (244-274), was the most resistive to filament formation. Its conformation remained unchanged. The peptide maintained the same random structure under both acidic and neutral conditions.
Catalog Number H-7982
One Letter Code QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Molecular Formula C₁₄₁H₂₃₈N₄₂O₄₄S
Relative Molecular Mass 3257.63
CAS Registry Number [330456-24-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Tau Peptides