Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Tau Peptide (245-274) (Repeat 1 Domain) trifluoroacetate salt
H-Thr-Ala-Pro-Val-Pro-Met-Pro-Asp-Leu-Lys-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-OH trifluoroacetate salt

4099396

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4099396.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 102.00
CHF 94.86 (7%)
4099396.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 173.00
CHF 160.89 (7%)
Add to Wish List
Add to Compare

Details

Sequence adjacent to the aggregating PHF6* motif (VQIINK). In PHF-tau, N-methylation of Lys²⁵⁴ and Lys²⁶⁷ and phosphorylation of Ser²⁶² was detected. If not methylated, Lys²⁵⁴ is an ubiquitinylation site.
Catalog Number H-7978
One Letter Code TAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Molecular Formula C₁₃₆H₂₃₀N₄₀O₄₂S
Relative Molecular Mass 3129.63
CAS Registry Number [1428134-39-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Tau Peptides