Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

(Asp³⁷)-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Asp-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

4099631

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4099631.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 301.00
CHF 279.93 (7%)
4099631.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 505.00
CHF 469.65 (7%)
Add to Wish List
Add to Compare

Details

The G37D mutant does not show the aggregation behavior of WT Abeta42 nor its neurotoxicity.
Catalog Number H-7842
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGVMVDGVVIA
Synonyms [Asp37] - beta - Amyloid (1 - 42), [Asp37]-Abeta (1-42), Human, Amyloid-beta Peptide(1-42), G37D, Human
Molecular Formula C₂₀₅H₃₁₃N₅₅O₆₂S
Relative Molecular Mass 4572.14
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease