Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

BNP-32 (human) hydrochloride salt
H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH hydrochloride salt
(Disulfide bond)

4095916

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4095916.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 122.00
CHF 113.46 (7%)
4095916.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 209.00
CHF 194.37 (7%)
Add to Wish List
Add to Compare
Catalog Number H-7774
APC Number 14-1-90
One Letter Code SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Synonyms Brain Natriuretic Peptide-32 (human), Nesiritide, BNP (1-32), human
Molecular Formula C₁₄₃H₂₄₄N₅₀O₄₂S₄
Relative Molecular Mass 3464.09
CAS Registry Number [124584-08-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Biomarker for cardiac diseases; Lipolysis-inducing peptide