Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

pTH (1-34) (human) trifluoroacetate salt
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH trifluoroacetate salt

4095855

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4095855.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 92.00
CHF 85.56 (7%)
4095855.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 153.00
CHF 142.29 (7%)
Add to Wish List
Add to Compare

Details

Intermittent administration of teriparatide stimulates bone formation by increasing the number of osteoblasts. Agonist of the parathyroid hormone receptor PTH1.
Catalog Number H-7736
APC Number 22-1-25
One Letter Code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Synonyms Teriparatide, Parathyroid Hormone (1-34), human (Teriparatide)
Molecular Formula C₁₈₁H₂₉₁N₅₅O₅₁S₂
Relative Molecular Mass 4117.77
CAS Registry Number [52232-67-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C