Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (1-40) amide trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-NH₂ trifluoroacetate salt

4095737

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4095737.0500 0.5 mg Ships within 3-5 business days  
CHF 163.00
CHF 151.59 (7%)
4095737.1000 1 mg Ships within 3-5 business days  
CHF 270.00
CHF 251.10 (7%)
Add to Wish List
Add to Compare
Catalog Number H-7664
APC Number 62-0-65
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV -NH₂
Synonyms β-Amyloid (1-40), amide
Molecular Formula C₁₉₄H₂₉₆N₅₄O₅₇S
Relative Molecular Mass 4328.88
CAS Registry Number [203460-31-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease