Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-37) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-OH trifluoroacetate salt

4062195

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4062195.0500 0.5 mg Ships within 3-5 business days  
CHF 230.00
CHF 213.90 (7%)
4062195.1000 1 mg Ships within 3-5 business days  
CHF 398.00
CHF 370.14 (7%)
Add to Wish List
Add to Compare
Catalog Number H-7462
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Formula C₁₈₂H₂₇₄N₅₀O₅₅S
Relative Molecular Mass 4074.55
CAS Registry Number [186359-67-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease