Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Galanin (mouse, rat)
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH₂

4030645

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030645.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4030645.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)
Add to Wish List
Add to Compare

Details

The isolation and characterization of cDNAs encoding rat galanin and its precursor peptide reveal that rat galanin is synthesized initially as part of a 124-amino acid precursor that includes a signal peptide, galanin, and a 60-amino acid galanin mRNA-associated peptide.
The neuropeptide galanin shows multiple inhibitory actions on neurotransmission and memory. In Alzheimer's disease, increased galanin-containing fibers hyperinnervate cholinergic neurons within the basal forebrain in association with a decline in cognition.
Catalog Number H-7450
APC Number 46-5-10
One Letter Code GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH₂
Molecular Formula C₁₄₁H₂₁₁N₄₃O₄₁
Relative Molecular Mass 3164.49
CAS Registry Number [114547-31-8]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease