Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

5-TAMRA-Amyloid β-Protein (1-42) trifluoroacetate salt

4090153

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4090153.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 267.00
CHF 248.31 (7%)
4090153.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,001.00
CHF 930.93 (7%)
Add to Wish List
Add to Compare
Catalog Number H-7448
One Letter Code TAMRA- DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLMVGGVVIA
Synonyms 5-TAMRA-Aβ42
Molecular Formula C₂₂₈H₃₃₁N₅₇O₆₄S
Relative Molecular Mass 4926.55
CAS Registry Number [1802087-80-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease