Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

5-FAM-Amyloid β-Protein (1-40) trifluoroacetate salt

4090152

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4090152.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 153.00
CHF 142.29 (7%)
4090152.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 607.00
CHF 564.51 (7%)
Add to Wish List
Add to Compare
Catalog Number H-7446
One Letter Code Fluorescein-5-carbonyl- DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLMVGGVV
Synonyms 5-FAM-Aβ40
Molecular Formula C₂₁₅H₃₀₅N₅₃O₆₄S
Relative Molecular Mass 4688.17
CAS Registry Number [1678416-08-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease