Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (5-42) ammonium salt
H-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH ammonium salt

4041241

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4041241.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 173.00
CHF 160.89 (7%)
4041241.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 607.00
CHF 564.51 (7%)
Add to Wish List
Add to Compare

Details

Abeta 5-42 is produced from amyloid precursor protein by action of caspases. It is deposited in Alzheimer's disease brain as well, but less prone to aggregation.
Catalog Number H-7436
One Letter Code RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Synonyms Aβ (5-42)
Molecular Formula C₁₈₂H₂₈₅N₅₁O₅₂S
Relative Molecular Mass 4051.64
CAS Registry Number [1678415-97-8]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease