Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GRP (human)
H-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH₂

4011693

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4011693.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 147.00
CHF 136.71 (7%)
4011693.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
Add to Wish List
Add to Compare

Details

GRP, a bombesin-like peptide, is involved in stress-induced anorexia.
Catalog Number H-6785
APC Number 46-1-70
One Letter Code VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH₂
Synonyms Gastrin Releasing Peptide, human
Molecular Formula C₁₃₀H₂₀₄N₃₈O₃₁S₂
Relative Molecular Mass 2859.42
CAS Registry Number [93755-85-2]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Obesity Research