Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

M65 trifluoroacetate salt
H-Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-NH₂ trifluoroacetate salt
(Disulfide bonds between Cys¹ and Cys⁵/Cys¹⁴ and Cys³²)

4067721

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4067721.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 357.00
CHF 332.01 (7%)
4067721.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 663.00
CHF 616.59 (7%)
Add to Wish List
Add to Compare

Details

Potent and specific PAC1 receptor antagonist.
Catalog Number H-6736
One Letter Code CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKEFKA-NH₂
Synonyms PAC1 Receptor Antagonist M65, (Des-Lys³⁸)-PAC1 Receptor Antagonist M65
Molecular Formula C₂₀₅H₃₂₆N₆₄O₆₁S₅
Relative Molecular Mass 4823.57
CAS Registry Number [1872440-65-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C