Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Gly²²)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4035372

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4035372.0500 0.5 mg Ships within 3-5 business days  
CHF 158.00
CHF 146.94 (7%)
4035372.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 262.00
CHF 243.66 (7%)
Add to Wish List
Add to Compare

Details

The highly neurotoxic arctic mutant (E22G) of Aβ has been used to study the mechanisms underlying the formation of soluble and insoluble β-amyloid aggregates. As the wild-type Aβ, the arctic mutant preferably assembles in the presence of GM1 ganglioside.
Catalog Number H-6694
APC Number 62-0-24
One Letter Code DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) Arctic Mutation, Amyloid β-Protein (1-40) E22G, [Gly22] β-Amyloid (1-40)
Molecular Formula C₁₉₁H₂₉₁N₅₃O₅₆S
Relative Molecular Mass 4257.80
CAS Registry Number [175010-18-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease