Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH trifluoroacetate salt

4034653

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4034653.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 294.00
CHF 273.42 (7%)
4034653.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 525.00
CHF 488.25 (7%)
Add to Wish List
Add to Compare

Details

Gastric inhibitory polypeptide (3-42) represents the major physiological degradation product of gastric inhibitory polypeptide (GIP). It is generated by proteolytic processing of GIP by dipeptidyl peptidase IV (DPP IV).
Catalog Number H-6614
One Letter Code EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Synonyms GIP (3-42) (human), Glucose-Dependent Insulinotropic Polypeptide (3-42) (human)
Molecular Formula C₂₁₄H₃₂₄N₅₈O₆₃S
Relative Molecular Mass 4749.35
CAS Registry Number [1802086-25-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes