Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Glu¹³·¹⁷·²⁰)-Osteocalcin (1-46) (mouse) trifluoroacetate salt
H-Tyr-Leu-Gly-Ala-Ser-Val-Pro-Ser-Pro-Asp-Pro-Leu-Glu-Pro-Thr-Arg-Glu-Gln-Cys-Glu-Leu-Asn-Pro-Ala-Cys-Asp-Glu-Leu-Ser-Asp-Gln-Tyr-Gly-Leu-Lys-Thr-Ala-Tyr-Lys-Arg-Ile-Tyr-Gly-Ile-Thr-Ile-OH trifluoroacetate salt
(Disulfide bond)

4057685

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4057685.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 410.00
CHF 381.30 (7%)
4057685.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 735.00
CHF 683.55 (7%)
Add to Wish List
Add to Compare

Details

Non-carboxylated osteocalcin was shown to be a bone-specific hormone involved in the regulation of glucose metabolism, for which the Gla peptide acts as precursor and transport form.
Catalog Number H-6552
One Letter Code YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI
Molecular Formula C₂₂₆H₃₅₁N₅₇O₇₄S₂
Relative Molecular Mass 5114.75
CAS Registry Number [1802086-27-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C