Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Nesfatin-1 (human) trifluoroacetate salt

4054143

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4054143.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 420.00
CHF 390.60 (7%)
4054143.0250 250 µg Ships within 3-5 business days  
CHF 1,681.00
CHF 1,563.33 (7%)
Add to Wish List
Add to Compare
Catalog Number H-6476
One Letter Code VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
Synonyms Nucleobindin-2 (25-106) (human), NUCB2 (25-106) (human), DNA-Binding Protein NEFA (25-106) (human), Gastric Cancer Antigen Zg4 (25-106) (human)
Molecular Formula C₄₂₇H₆₉₁N₁₁₃O₁₃₄
Relative Molecular Mass 9551.87
CAS Registry Number [917528-35-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide