Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Arg¹⁷)-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Arg-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

4050111

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4050111.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 236.00
CHF 219.48 (7%)
4050111.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 419.00
CHF 389.67 (7%)
Add to Wish List
Add to Compare

Details

The L17R mutant shows a reduced propensity to aggregate.
Catalog Number H-6448
One Letter Code DAEFRHDSGYEVHHQKRVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Formula C₂₀₃H₃₁₂N₅₈O₆₀S
Relative Molecular Mass 4557.13
CAS Registry Number [1802085-97-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease