Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Glu²⁰)-Amyloid β-Protein (1-42)
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Glu-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

4050112

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4050112.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 236.00
CHF 219.48 (7%)
4050112.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 419.00
CHF 389.67 (7%)
Add to Wish List
Add to Compare

Details

The Aβ F20E mutant forms fibrils in vitro although much slower than the wild-type Aβ 1-42. In vivo, deposits of F20E have not been observed, possibly due to the retarded aggregation which permits concomitant enzymatic degradation.
Catalog Number H-6446
One Letter Code DAEFRHDSGYEVHHQKLVFEAEDVGSNKGAIIGLMVGGVVIA
Synonyms Amyloid β-Protein (1-42) F20E
Molecular Formula C₁₉₉H₃₀₉N₅₅O₆₂S
Relative Molecular Mass 4496.04
CAS Registry Number [1802086-22-1]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease