Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Gly²²)-Amyloid β-Protein (1-42)
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

4035371

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4035371.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 211.00
CHF 196.23 (7%)
4035371.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)
Add to Wish List
Add to Compare

Details

The arctic mutant of amyloid β peptide 1-42, in which Glu²² is substituted by Gly, is distinctly more amyloidogenic than the wild-type Aβ 1-42.
Catalog Number H-6124
One Letter Code DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
Synonyms Amyloid β-Protein (1-42) Arctic Mutation, Amyloid β-Protein (1-42) E22G
Molecular Formula C₂₀₀H₃₀₇N₅₅O₅₈S
Relative Molecular Mass 4442.04
CAS Registry Number [1802086-23-2]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease