Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Galanin-Like Peptide (human) trifluoroacetate salt
H-Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro-Pro-Gln-Pro-Ser-OH trifluoroacetate salt

4044537

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4044537.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 840.00
CHF 781.20 (7%)
4044537.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,366.00
CHF 1,270.38 (7%)
Add to Wish List
Add to Compare

Details

Galanin-like peptide (GALP) is a 60 amino acid neuropeptide first isolated from the porcine hypothalamus and subsequently also identified in rats and humans. GALP exhibits a higher affinity (~18-fold) for the GALR2 receptor compared to the GALR1 receptor, whereas galanin is relatively non-selective. Investigations of the physiological role of GALP revealed that GALP induces food intake with a ten times higher orexigenic activity than galanin. Furthermore, GALP could affect the emotional state in the CNS. Therefore, GALP represents an orexigenic and anxiogenic peptide.
Catalog Number H-6078
One Letter Code APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
Synonyms GALP (human)
Molecular Formula C₂₉₂H₄₅₁N₈₃O₈₄S
Relative Molecular Mass 6500.37
CAS Registry Number [245114-99-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Obesity Research