Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt
H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-OH trifluoroacetate salt
(Disulfide bonds between Cys¹ and Cys¹⁵/Cys³ and Cys¹¹)

4038346

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4038346.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,324.00
CHF 1,231.32 (7%)
4038346.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 2,385.00
CHF 2,218.05 (7%)
Add to Wish List
Add to Compare

Details

Big ET-1 (1-31) exhibited chemotactic activities towards human neutrophils and monocytes which could be inhibited by the ET-A receptor antagonist BQ-123 (H-1252) but not by the ET-B receptor antagonist BQ-788 (H-2492).
Catalog Number H-5818
One Letter Code CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY
Synonyms Big ET-1 (1-31) (human, bovine)
Molecular Formula C₁₆₂H₂₃₆N₃₈O₄₇S₅
Relative Molecular Mass 3628.21
CAS Registry Number [133972-52-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Chemotactic peptide