Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

VIP (guinea pig) trifluoroacetate salt
H-His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH₂ trifluoroacetate salt

4035970

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4035970.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
Add to Wish List
Add to Compare

Details

This vasoactive intestinal peptide (VIP) from guinea pig differs from other mammalian species by four amino acids. The substitution of the four amino acids in positions 5, 9, 19, and 26 by neutral amino acids does not have any effect on its biological activity.
Catalog Number H-5682
APC Number 48-6-15
One Letter Code HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH₂
Molecular Formula C₁₄₇H₂₃₉N₄₃O₄₂S₂
Relative Molecular Mass 3344.91
CAS Registry Number [96886-24-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C