Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-40) (mouse, rat)
H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

4035886

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4035886.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 221.00
CHF 205.53 (7%)
4035886.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 367.00
CHF 341.31 (7%)
Add to Wish List
Add to Compare
Catalog Number H-5638
APC Number 62-0-86
One Letter Code DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms β-Amyloid (1-40), rat
Molecular Formula C₁₉₀H₂₉₁N₅₁O₅₇S
Relative Molecular Mass 4233.78
CAS Registry Number [144409-98-3]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease