Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Stresscopin (human)
H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH₂

4037535

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4037535.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 630.00
CHF 585.90 (7%)
4037535.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,051.00
CHF 977.43 (7%)
Add to Wish List
Add to Compare

Details

Stresscopin is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2). Transcripts are expressed in brain and most tissues analyzed. Intraperitoneal injections of stresscopin suppresses heat-induced edema formation in anesthetized rats. It also decreases food intake and exhibits an inhibitory effect on gastric emptying activity. This CRHR2 agonist might represent an endogenous ligand for maintaining homeostasis after stress.
Catalog Number H-5546
APC Number 68-2-00
One Letter Code TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH₂
Synonyms SCP (human)
Molecular Formula C₁₉₅H₃₂₆N₅₆O₅₃S₂
Relative Molecular Mass 4367.21
CAS Registry Number [352020-03-2]
Source Synthetic
Storage Conditions -20 ± 5 °C