Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Tyr³⁶)-pTH-Related Protein (1-36) amide (chicken)
H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Ile-Phe-Leu-Gln-Asn-Leu-Ile-Glu-Gly-Val-Asn-Thr-Ala-Glu-Tyr-NH₂

4037180

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4037180.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 294.00
CHF 273.42 (7%)
4037180.1000 1 mg Ships within 3-5 business days  
CHF 504.00
CHF 468.72 (7%)
Add to Wish List
Add to Compare

Details

Zhao et al. observed that treatment with chicken PTHrP (1-36) stimulated differentiation of both chondrogenic and osteogenic cells in cultures of mandibular mesenchymal cells.
Catalog Number H-5496
One Letter Code AVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEY-NH₂
Synonyms (Tyr³⁶)-pTHrp (1-36) amide (chicken), (Tyr³⁶)-Hypercalcemia of Malignancy Factor (1-36) amide (chicken)
Molecular Formula C₁₈₄H₃₀₁N₅₇O₅₅
Relative Molecular Mass 4191.76
CAS Registry Number [152617-91-9]
Source Synthetic
Storage Conditions -20 ± 5 °C