Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH trifluoroacetate salt

4034865

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4034865.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4034865.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,051.00
CHF 977.43 (7%)
Add to Wish List
Add to Compare
Catalog Number H-5102
One Letter Code HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Synonyms Insulinotropin trifluoroacetate salt, Glucagon-Like Peptide 1 (7-37), Preproglucagon (98-128), Proglucagon (78-108)
Molecular Formula C₁₅₁H₂₂₈N₄₀O₄₇
Relative Molecular Mass 3355.71
CAS Registry Number [106612-94-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes