Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GLP-2 (rat)
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH

4034866

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4034866.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 210.00
CHF 195.30 (7%)
4034866.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 378.00
CHF 351.54 (7%)
Add to Wish List
Add to Compare

Details

GLP-2 administration to mice or rats promotes stimulation of crypt cell proliferation and inhibition of enterocyte apoptosis resulting in hyperplasia of the small bowel villous epithelium. It also exerts trophic effects in animal models of both small and large bowel injury such as experimental small bowel resection or chemically induced colitis. In addition to stimulation of epithelial proliferation, GLP-2 also acutely regulates gastric emptying and exerts rapid metabolic effects promoting stimulation of intestinal hexose transport. The actions of GLP-2 are transduced via the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Catalog Number H-5002
APC Number 46-4-18
One Letter Code HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Synonyms Glucagon-Like Peptide 2 (rat), Preproglucagon (146-178) (rat), Proglucagon (126-158) (rat), Glucagon-Like Peptide II, rat
Molecular Formula C₁₆₆H₂₅₆N₄₄O₅₆S
Relative Molecular Mass 3796.19
CAS Registry Number [195262-56-7]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Apoptosis & Necrosis
Diabetes